KLF12 polyclonal antibody (A01)
  • KLF12 polyclonal antibody (A01)

KLF12 polyclonal antibody (A01)

Ref: AB-H00011278-A01
KLF12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KLF12.
Información adicional
Size 50 uL
Gene Name KLF12
Gene Alias AP-2rep|AP2REP|HSPC122
Gene Description Kruppel-like factor 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF12 (NP_009180, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11278

Enviar un mensaje


KLF12 polyclonal antibody (A01)

KLF12 polyclonal antibody (A01)