TREX1 monoclonal antibody (M05), clone 1B1
  • TREX1 monoclonal antibody (M05), clone 1B1

TREX1 monoclonal antibody (M05), clone 1B1

Ref: AB-H00011277-M05
TREX1 monoclonal antibody (M05), clone 1B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TREX1.
Información adicional
Size 100 ug
Gene Name TREX1
Gene Alias AGS1|AGS5|CRV|DKFZp434J0310|DRN3|HERNS
Gene Description three prime repair exonuclease 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TREX1 (NP_057465, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11277
Clone Number 1B1
Iso type IgG2a Kappa

Enviar un mensaje


TREX1 monoclonal antibody (M05), clone 1B1

TREX1 monoclonal antibody (M05), clone 1B1