TREX1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TREX1 purified MaxPab rabbit polyclonal antibody (D01P)

TREX1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011277-D01P
TREX1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TREX1 protein.
Información adicional
Size 100 ug
Gene Name TREX1
Gene Alias AGS1|AGS5|CRV|DKFZp434J0310|DRN3|HERNS
Gene Description three prime repair exonuclease 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce
Immunogen Prot. Seq MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLGSIYTRLYGQSPPDSHTAEGD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TREX1 (NP_057465.1, 1 a.a. ~ 369 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11277

Enviar un mensaje


TREX1 purified MaxPab rabbit polyclonal antibody (D01P)

TREX1 purified MaxPab rabbit polyclonal antibody (D01P)