TREX1 polyclonal antibody (A01)
  • TREX1 polyclonal antibody (A01)

TREX1 polyclonal antibody (A01)

Ref: AB-H00011277-A01
TREX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TREX1.
Información adicional
Size 50 uL
Gene Name TREX1
Gene Alias AGS1|AGS5|CRV|DKFZp434J0310|DRN3|HERNS
Gene Description three prime repair exonuclease 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TREX1 (NP_057465, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11277

Enviar un mensaje


TREX1 polyclonal antibody (A01)

TREX1 polyclonal antibody (A01)