CHP monoclonal antibody (M02), clone S2
  • CHP monoclonal antibody (M02), clone S2

CHP monoclonal antibody (M02), clone S2

Ref: AB-H00011261-M02
CHP monoclonal antibody (M02), clone S2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CHP.
Información adicional
Size 100 ug
Gene Name CHP
Gene Alias SLC9A1BP
Gene Description calcium binding protein P22
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MESHSVTQAGVQWRDLGSLQPLPPGFKQFSHLSLPSSWDYRRVPPYLGNFCIFSGEGVSPCWPGWS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHP (AAH08373, 1 a.a. ~ 66 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11261
Clone Number S2
Iso type IgG2a Kappa

Enviar un mensaje


CHP monoclonal antibody (M02), clone S2

CHP monoclonal antibody (M02), clone S2