TP53TG1 purified MaxPab mouse polyclonal antibody (B01P)
  • TP53TG1 purified MaxPab mouse polyclonal antibody (B01P)

TP53TG1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011257-B01P
TP53TG1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TP53TG1 protein.
Información adicional
Size 50 ug
Gene Name TP53TG1
Gene Alias NCRNA00096|P53TG1|P53TG1-D|TP53AP1
Gene Description TP53 target 1 (non-protein coding)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMLGSLAPDPGSRRHSGQAALRPRRYPTLWDRCRKRWLRPIFTQLLAAGLAYHTLLPIPSEPLFAAPGEHLHQCFVKESYCPPRVLAKEQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TP53TG1 (AAH02709.1, 1 a.a. ~ 90 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11257

Enviar un mensaje


TP53TG1 purified MaxPab mouse polyclonal antibody (B01P)

TP53TG1 purified MaxPab mouse polyclonal antibody (B01P)