HRH3 polyclonal antibody (A01)
  • HRH3 polyclonal antibody (A01)

HRH3 polyclonal antibody (A01)

Ref: AB-H00011255-A01
HRH3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HRH3.
Información adicional
Size 50 uL
Gene Name HRH3
Gene Alias GPCR97|HH3R
Gene Description histamine receptor H3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HRH3 (NP_009163, 257 a.a. ~ 359 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11255

Enviar un mensaje


HRH3 polyclonal antibody (A01)

HRH3 polyclonal antibody (A01)