CA5B monoclonal antibody (M06), clone 1E12
  • CA5B monoclonal antibody (M06), clone 1E12

CA5B monoclonal antibody (M06), clone 1E12

Ref: AB-H00011238-M06
CA5B monoclonal antibody (M06), clone 1E12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CA5B.
Información adicional
Size 100 ug
Gene Name CA5B
Gene Alias CA-VB|MGC39962
Gene Description carbonic anhydrase VB, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CA5B (AAH28142, 1 a.a. ~ 317 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11238
Clone Number 1E12
Iso type IgG1 Kappa

Enviar un mensaje


CA5B monoclonal antibody (M06), clone 1E12

CA5B monoclonal antibody (M06), clone 1E12