RNF139 polyclonal antibody (A01)
  • RNF139 polyclonal antibody (A01)

RNF139 polyclonal antibody (A01)

Ref: AB-H00011236-A01
RNF139 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF139.
Información adicional
Size 50 uL
Gene Name RNF139
Gene Alias HRCA1|MGC31961|RCA1|TRC8
Gene Description ring finger protein 139
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF139 (NP_009149, 565 a.a. ~ 664 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11236

Enviar un mensaje


RNF139 polyclonal antibody (A01)

RNF139 polyclonal antibody (A01)