RASSF8 MaxPab rabbit polyclonal antibody (D01)
  • RASSF8 MaxPab rabbit polyclonal antibody (D01)

RASSF8 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011228-D01
RASSF8 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RASSF8 protein.
Información adicional
Size 100 uL
Gene Name RASSF8
Gene Alias C12orf2|HoJ-1
Gene Description Ras association (RalGDS/AF-6) domain family (N-terminal) member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAKGLMDIFGKGKETEFKQKVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNSNLEEEIVRLEQKIKRNDVEIEEEEFWENELQIEQENEKQLKDQLQEIRQKITECE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RASSF8 (NP_009142.2, 1 a.a. ~ 392 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11228

Enviar un mensaje


RASSF8 MaxPab rabbit polyclonal antibody (D01)

RASSF8 MaxPab rabbit polyclonal antibody (D01)