GALNT6 monoclonal antibody (M01), clone 4C10
  • GALNT6 monoclonal antibody (M01), clone 4C10

GALNT6 monoclonal antibody (M01), clone 4C10

Ref: AB-H00011226-M01
GALNT6 monoclonal antibody (M01), clone 4C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GALNT6.
Información adicional
Size 100 ug
Gene Name GALNT6
Gene Alias GALNAC-T6|GalNAcT6
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq IMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GALNT6 (NP_009141, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11226
Clone Number 4C10
Iso type IgG1 Kappa

Enviar un mensaje


GALNT6 monoclonal antibody (M01), clone 4C10

GALNT6 monoclonal antibody (M01), clone 4C10