DDX20 monoclonal antibody (M01), clone 5H5
  • DDX20 monoclonal antibody (M01), clone 5H5

DDX20 monoclonal antibody (M01), clone 5H5

Ref: AB-H00011218-M01
DDX20 monoclonal antibody (M01), clone 5H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DDX20.
Información adicional
Size 100 ug
Gene Name DDX20
Gene Alias DKFZp434H052|DP103|GEMIN3
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq EGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX20 (NP_009135, 725 a.a. ~ 824 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11218
Clone Number 5H5
Iso type IgG2a Kappa

Enviar un mensaje


DDX20 monoclonal antibody (M01), clone 5H5

DDX20 monoclonal antibody (M01), clone 5H5