AKAP13 monoclonal antibody (M01), clone 5B7
  • AKAP13 monoclonal antibody (M01), clone 5B7

AKAP13 monoclonal antibody (M01), clone 5B7

Ref: AB-H00011214-M01
AKAP13 monoclonal antibody (M01), clone 5B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AKAP13.
Información adicional
Size 100 ug
Gene Name AKAP13
Gene Alias AKAP-Lbc|ARHGEF13|BRX|FLJ11952|FLJ43341|HA-3|Ht31|LBC|PROTO-LB|PROTO-LBC|c-lbc
Gene Description A kinase (PRKA) anchor protein 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKAP13 (NP_006729, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11214
Clone Number 5B7
Iso type IgG2a Kappa

Enviar un mensaje


AKAP13 monoclonal antibody (M01), clone 5B7

AKAP13 monoclonal antibody (M01), clone 5B7