IRAK3 monoclonal antibody (M04), clone 1G11
  • IRAK3 monoclonal antibody (M04), clone 1G11

IRAK3 monoclonal antibody (M04), clone 1G11

Ref: AB-H00011213-M04
IRAK3 monoclonal antibody (M04), clone 1G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IRAK3.
Información adicional
Size 100 ug
Gene Name IRAK3
Gene Alias ASRT5|FLJ13601|IRAK-M|IRAKM
Gene Description interleukin-1 receptor-associated kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRAK3 (AAH57800, 497 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11213
Clone Number 1G11
Iso type IgG1 Kappa

Enviar un mensaje


IRAK3 monoclonal antibody (M04), clone 1G11

IRAK3 monoclonal antibody (M04), clone 1G11