IRAK3 MaxPab rabbit polyclonal antibody (D01)
  • IRAK3 MaxPab rabbit polyclonal antibody (D01)

IRAK3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011213-D01
IRAK3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IRAK3 protein.
Información adicional
Size 100 uL
Gene Name IRAK3
Gene Alias ASRT5|FLJ13601|IRAK-M|IRAKM
Gene Description interleukin-1 receptor-associated kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEVLLLFHHPNILELAAYFTETEKFCLIYPYMRNGTLFDRLQC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRAK3 (NP_009130.1, 1 a.a. ~ 596 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11213

Enviar un mensaje


IRAK3 MaxPab rabbit polyclonal antibody (D01)

IRAK3 MaxPab rabbit polyclonal antibody (D01)