Ver mas grande
CHEK2 monoclonal antibody (M03), clone 3E10
AB-H00011200-M03
Producto nuevo
CHEK2 monoclonal antibody (M03), clone 3E10
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | CHEK2 |
| Gene Alias | CDS1|CHK2|HuCds1|LFS2|PP1425|RAD53 |
| Gene Description | CHK2 checkpoint homolog (S. pombe) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,IHC-P,ELISA |
| Immunogen Prot. Seq | MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CHEK2 (AAH04207.1, 1 a.a. ~ 543 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 11200 |
| Clone Number | 3E10 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant CHEK2.