CHEK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CHEK2 purified MaxPab rabbit polyclonal antibody (D01P)

CHEK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011200-D01P
CHEK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CHEK2 protein.
Información adicional
Size 100 ug
Gene Name CHEK2
Gene Alias CDS1|CHK2|HuCds1|LFS2|PP1425|RAD53
Gene Description CHK2 checkpoint homolog (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHEK2 (NP_009125.1, 1 a.a. ~ 543 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11200

Enviar un mensaje


CHEK2 purified MaxPab rabbit polyclonal antibody (D01P)

CHEK2 purified MaxPab rabbit polyclonal antibody (D01P)