ANXA10 purified MaxPab rabbit polyclonal antibody (D01P)
  • ANXA10 purified MaxPab rabbit polyclonal antibody (D01P)

ANXA10 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011199-D01P
ANXA10 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ANXA10 protein.
Información adicional
Size 100 ug
Gene Name ANXA10
Gene Alias ANX14
Gene Description annexin A10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGDMREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANXA10 (NP_009124.2, 1 a.a. ~ 324 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11199

Enviar un mensaje


ANXA10 purified MaxPab rabbit polyclonal antibody (D01P)

ANXA10 purified MaxPab rabbit polyclonal antibody (D01P)