SUPT16H monoclonal antibody (M04), clone 1F1
  • SUPT16H monoclonal antibody (M04), clone 1F1

SUPT16H monoclonal antibody (M04), clone 1F1

Ref: AB-H00011198-M04
SUPT16H monoclonal antibody (M04), clone 1F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SUPT16H.
Información adicional
Size 100 ug
Gene Name SUPT16H
Gene Alias CDC68|FACT|FACTP140|FLJ10857|FLJ14010|FLJ34357|SPT16/CDC68
Gene Description suppressor of Ty 16 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUPT16H (NP_009123, 608 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11198
Clone Number 1F1
Iso type IgG2b Kappa

Enviar un mensaje


SUPT16H monoclonal antibody (M04), clone 1F1

SUPT16H monoclonal antibody (M04), clone 1F1