PTENP1 purified MaxPab mouse polyclonal antibody (B01P)
  • PTENP1 purified MaxPab mouse polyclonal antibody (B01P)

PTENP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011191-B01P
PTENP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PTENP1 protein.
Información adicional
Size 50 ug
Gene Name PTENP1
Gene Alias PTEN-rs|PTEN2|PTH2|psiPTEN
Gene Description phosphatase and tensin homolog pseudogene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIHNLCAERHYDTAKSNYRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGIMIYAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLVKNHVDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKMYSSNSGPTRWEDKFMYFEFPQPLPVCGGIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTENP1 (AAH38293.1, 1 a.a. ~ 369 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11191

Enviar un mensaje


PTENP1 purified MaxPab mouse polyclonal antibody (B01P)

PTENP1 purified MaxPab mouse polyclonal antibody (B01P)