CEP250 monoclonal antibody (M02), clone 4A1
  • CEP250 monoclonal antibody (M02), clone 4A1

CEP250 monoclonal antibody (M02), clone 4A1

Ref: AB-H00011190-M02
CEP250 monoclonal antibody (M02), clone 4A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CEP250.
Información adicional
Size 100 ug
Gene Name CEP250
Gene Alias C-NAP1|CEP2|CNAP1|MGC88542
Gene Description centrosomal protein 250kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CEP250 (AAH01433, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11190
Clone Number 4A1
Iso type IgG2a Kappa

Enviar un mensaje


CEP250 monoclonal antibody (M02), clone 4A1

CEP250 monoclonal antibody (M02), clone 4A1