PKP3 purified MaxPab mouse polyclonal antibody (B01P)
  • PKP3 purified MaxPab mouse polyclonal antibody (B01P)

PKP3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011187-B01P
PKP3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PKP3 protein.
Información adicional
Size 50 ug
Gene Name PKP3
Gene Alias -
Gene Description plakophilin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQDGNFLLSALQPEAGVCSLALPSDLQLDRRGAEGPEAERLRAARVQEQVRARLLQLGQQPRHNGAAEPEPEAETARGTSRGQYHTLQAGFSSRSQGLSGDKTSGFRPIAKPAYSPASWSSRSAVDLSCSRRLSSAHNGGSAFGAAGYGGAQPTPPMPTRPVSFHERGGVGSRADYDTLSLRSLRLGPGGLDDRYSLVSEQLEPAATSTYRAFAYERQASSSSSRAGGLDWPEATEVSPSRTIRAPAVRTLQRFQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PKP3 (ABM85801.1, 1 a.a. ~ 797 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11187

Enviar un mensaje


PKP3 purified MaxPab mouse polyclonal antibody (B01P)

PKP3 purified MaxPab mouse polyclonal antibody (B01P)