MAP4K1 polyclonal antibody (A01)
  • MAP4K1 polyclonal antibody (A01)

MAP4K1 polyclonal antibody (A01)

Ref: AB-H00011184-A01
MAP4K1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAP4K1.
Información adicional
Size 50 uL
Gene Name MAP4K1
Gene Alias HPK1
Gene Description mitogen-activated protein kinase kinase kinase kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP4K1 (NP_009112, 278 a.a. ~ 377 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11184

Enviar un mensaje


MAP4K1 polyclonal antibody (A01)

MAP4K1 polyclonal antibody (A01)