BAZ2A purified MaxPab mouse polyclonal antibody (B01P)
  • BAZ2A purified MaxPab mouse polyclonal antibody (B01P)

BAZ2A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011176-B01P
BAZ2A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BAZ2A protein.
Información adicional
Size 50 ug
Gene Name BAZ2A
Gene Alias DKFZp781B109|FLJ13768|FLJ13780|FLJ45876|KIAA0314|TIP5|WALp3
Gene Description bromodomain adjacent to zinc finger domain, 2A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEMEANDHFNFTGLPPAPAASGLKPSPSSGEGLYTNGSPMNFPQQGKSLNGDVNVNGLSTVSHTTTSGILNSAPHSSSTSHLHHPSVAYDCLWNYSQYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BAZ2A (NP_038477.2, 1 a.a. ~ 1905 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11176

Enviar un mensaje


BAZ2A purified MaxPab mouse polyclonal antibody (B01P)

BAZ2A purified MaxPab mouse polyclonal antibody (B01P)