PSIP1 monoclonal antibody (M01), clone 3H1
  • PSIP1 monoclonal antibody (M01), clone 3H1

PSIP1 monoclonal antibody (M01), clone 3H1

Ref: AB-H00011168-M01
PSIP1 monoclonal antibody (M01), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PSIP1.
Información adicional
Size 100 ug
Gene Name PSIP1
Gene Alias DFS70|LEDGF|MGC74712|PAIP|PSIP2|p52|p75
Gene Description PC4 and SFRS1 interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11168
Clone Number 3H1
Iso type IgG1 kappa

Enviar un mensaje


PSIP1 monoclonal antibody (M01), clone 3H1

PSIP1 monoclonal antibody (M01), clone 3H1