NUDT5 monoclonal antibody (M04), clone 2A3
  • NUDT5 monoclonal antibody (M04), clone 2A3

NUDT5 monoclonal antibody (M04), clone 2A3

Ref: AB-H00011164-M04
NUDT5 monoclonal antibody (M04), clone 2A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NUDT5.
Información adicional
Size 100 ug
Gene Name NUDT5
Gene Alias YSA1|YSA1H|hYSAH1
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq KGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUDT5 (NP_054861, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11164
Clone Number 2A3
Iso type IgG1 Kappa

Enviar un mensaje


NUDT5 monoclonal antibody (M04), clone 2A3

NUDT5 monoclonal antibody (M04), clone 2A3