NUDT5 purified MaxPab rabbit polyclonal antibody (D01P)
  • NUDT5 purified MaxPab rabbit polyclonal antibody (D01P)

NUDT5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011164-D01P
NUDT5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NUDT5 protein.
Información adicional
Size 100 ug
Gene Name NUDT5
Gene Alias YSA1|YSA1H|hYSAH1
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NUDT5 (NP_054861.2, 1 a.a. ~ 219 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11164

Enviar un mensaje


NUDT5 purified MaxPab rabbit polyclonal antibody (D01P)

NUDT5 purified MaxPab rabbit polyclonal antibody (D01P)