RABL2B purified MaxPab rabbit polyclonal antibody (D01P)
  • RABL2B purified MaxPab rabbit polyclonal antibody (D01P)

RABL2B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011158-D01P
RABL2B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RABL2B protein.
Información adicional
Size 100 ug
Gene Name RABL2B
Gene Alias FLJ93981|FLJ98216
Gene Description RAB, member of RAS oncogene family-like 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RABL2B (NP_001003789.1, 1 a.a. ~ 229 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11158

Enviar un mensaje


RABL2B purified MaxPab rabbit polyclonal antibody (D01P)

RABL2B purified MaxPab rabbit polyclonal antibody (D01P)