LSM6 monoclonal antibody (M01), clone 4B5-1B10
  • LSM6 monoclonal antibody (M01), clone 4B5-1B10

LSM6 monoclonal antibody (M01), clone 4B5-1B10

Ref: AB-H00011157-M01
LSM6 monoclonal antibody (M01), clone 4B5-1B10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant LSM6.
Información adicional
Size 100 ug
Gene Name LSM6
Gene Alias YDR378C
Gene Description LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LSM6 (AAH16026, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11157
Clone Number 4B5-1B10
Iso type IgG1 kappa

Enviar un mensaje


LSM6 monoclonal antibody (M01), clone 4B5-1B10

LSM6 monoclonal antibody (M01), clone 4B5-1B10