DMC1 monoclonal antibody (M10), clone 4A10
  • DMC1 monoclonal antibody (M10), clone 4A10

DMC1 monoclonal antibody (M10), clone 4A10

Ref: AB-H00011144-M10
DMC1 monoclonal antibody (M10), clone 4A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DMC1.
Información adicional
Size 100 ug
Gene Name DMC1
Gene Alias DMC1H|HsLim15|LIM15|MGC150472|MGC150473|dJ199H16.1
Gene Description DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DMC1 (NP_008999, 237 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11144
Clone Number 4A10
Iso type IgG2a Kappa

Enviar un mensaje


DMC1 monoclonal antibody (M10), clone 4A10

DMC1 monoclonal antibody (M10), clone 4A10