KPTN purified MaxPab rabbit polyclonal antibody (D01P)
  • KPTN purified MaxPab rabbit polyclonal antibody (D01P)

KPTN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011133-D01P
KPTN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KPTN protein.
Información adicional
Size 100 ug
Gene Name KPTN
Gene Alias 2E4
Gene Description kaptin (actin binding protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KPTN (NP_008990.2, 1 a.a. ~ 436 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11133

Enviar un mensaje


KPTN purified MaxPab rabbit polyclonal antibody (D01P)

KPTN purified MaxPab rabbit polyclonal antibody (D01P)