ZWINT purified MaxPab mouse polyclonal antibody (B01P)
  • ZWINT purified MaxPab mouse polyclonal antibody (B01P)

ZWINT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011130-B01P
ZWINT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZWINT protein.
Información adicional
Size 50 ug
Gene Name ZWINT
Gene Alias HZwint-1|KNTC2AP|MGC117174|ZWINT1
Gene Description ZW10 interactor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDGVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZWINT (AAH20979.1, 1 a.a. ~ 277 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11130

Enviar un mensaje


ZWINT purified MaxPab mouse polyclonal antibody (B01P)

ZWINT purified MaxPab mouse polyclonal antibody (B01P)