CD160 MaxPab rabbit polyclonal antibody (D01)
  • CD160 MaxPab rabbit polyclonal antibody (D01)

CD160 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011126-D01
CD160 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD160 protein.
Información adicional
Size 100 uL
Gene Name CD160
Gene Alias BY55|FLJ46513|NK1|NK28
Gene Description CD160 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD160 (AAH14465.1, 1 a.a. ~ 181 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11126

Enviar un mensaje


CD160 MaxPab rabbit polyclonal antibody (D01)

CD160 MaxPab rabbit polyclonal antibody (D01)