CD160 polyclonal antibody (A01)
  • CD160 polyclonal antibody (A01)

CD160 polyclonal antibody (A01)

Ref: AB-H00011126-A01
CD160 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CD160.
Información adicional
Size 50 uL
Gene Name CD160
Gene Alias BY55|FLJ46513|NK1|NK28
Gene Description CD160 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD160 (AAH14465.1, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11126

Enviar un mensaje


CD160 polyclonal antibody (A01)

CD160 polyclonal antibody (A01)