BTN3A2 purified MaxPab mouse polyclonal antibody (B01P)
  • BTN3A2 purified MaxPab mouse polyclonal antibody (B01P)

BTN3A2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011118-B01P
BTN3A2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BTN3A2 protein.
Información adicional
Size 50 ug
Gene Name BTN3A2
Gene Alias BT3.2|BT3.3|BTF4
Gene Description butyrophilin, subfamily 3, member A2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKMASSLAFLLLNFHVSLLLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWIAALAGT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BTN3A2 (NP_008978.2, 1 a.a. ~ 334 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11118

Enviar un mensaje


BTN3A2 purified MaxPab mouse polyclonal antibody (B01P)

BTN3A2 purified MaxPab mouse polyclonal antibody (B01P)