FGFR1OP purified MaxPab rabbit polyclonal antibody (D01P)
  • FGFR1OP purified MaxPab rabbit polyclonal antibody (D01P)

FGFR1OP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011116-D01P
FGFR1OP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FGFR1OP protein.
Información adicional
Size 100 ug
Gene Name FGFR1OP
Gene Alias FOP
Gene Description FGFR1 oncogene partner
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FGFR1OP (NP_008976.1, 1 a.a. ~ 399 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11116

Enviar un mensaje


FGFR1OP purified MaxPab rabbit polyclonal antibody (D01P)

FGFR1OP purified MaxPab rabbit polyclonal antibody (D01P)