PRDM4 monoclonal antibody (M03), clone 4H7
  • PRDM4 monoclonal antibody (M03), clone 4H7

PRDM4 monoclonal antibody (M03), clone 4H7

Ref: AB-H00011108-M03
PRDM4 monoclonal antibody (M03), clone 4H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRDM4.
Información adicional
Size 100 ug
Gene Name PRDM4
Gene Alias MGC45046|PFM1
Gene Description PR domain containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRDM4 (NP_036538, 476 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11108
Clone Number 4H7
Iso type IgG2a Kappa

Enviar un mensaje


PRDM4 monoclonal antibody (M03), clone 4H7

PRDM4 monoclonal antibody (M03), clone 4H7