RPP14 monoclonal antibody (M01A), clone 3H4
  • RPP14 monoclonal antibody (M01A), clone 3H4

RPP14 monoclonal antibody (M01A), clone 3H4

Ref: AB-H00011102-M01A
RPP14 monoclonal antibody (M01A), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPP14.
Información adicional
Size 200 uL
Gene Name RPP14
Gene Alias FLJ31508|P14
Gene Description ribonuclease P/MRP 14kDa subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPP14 (NP_008973, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 11102
Clone Number 3H4
Iso type IgG2a Kappa

Enviar un mensaje


RPP14 monoclonal antibody (M01A), clone 3H4

RPP14 monoclonal antibody (M01A), clone 3H4