RPP14 polyclonal antibody (A01)
  • RPP14 polyclonal antibody (A01)

RPP14 polyclonal antibody (A01)

Ref: AB-H00011102-A01
RPP14 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPP14.
Información adicional
Size 50 uL
Gene Name RPP14
Gene Alias FLJ31508|P14
Gene Description ribonuclease P/MRP 14kDa subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPP14 (NP_008973, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11102

Enviar un mensaje


RPP14 polyclonal antibody (A01)

RPP14 polyclonal antibody (A01)