ADAMTS13 polyclonal antibody (A01)
  • ADAMTS13 polyclonal antibody (A01)

ADAMTS13 polyclonal antibody (A01)

Ref: AB-H00011093-A01
ADAMTS13 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ADAMTS13.
Información adicional
Size 50 uL
Gene Name ADAMTS13
Gene Alias C9orf8|DKFZp434C2322|FLJ42993|MGC118899|MGC118900|TTP|VWFCP|vWF-CP
Gene Description ADAM metallopeptidase with thrombospondin type 1 motif, 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ADAMTS13 (NP_620594, 1328 a.a. ~ 1427 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11093

Enviar un mensaje


ADAMTS13 polyclonal antibody (A01)

ADAMTS13 polyclonal antibody (A01)