ESM1 monoclonal antibody (M02), clone 6D4
  • ESM1 monoclonal antibody (M02), clone 6D4

ESM1 monoclonal antibody (M02), clone 6D4

Ref: AB-H00011082-M02
ESM1 monoclonal antibody (M02), clone 6D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ESM1.
Información adicional
Size 100 ug
Gene Name ESM1
Gene Alias endocan
Gene Description endothelial cell-specific molecule 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq PSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ESM1 (NP_008967, 85 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11082
Clone Number 6D4
Iso type IgG2b Kappa

Enviar un mensaje


ESM1 monoclonal antibody (M02), clone 6D4

ESM1 monoclonal antibody (M02), clone 6D4