ESM1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ESM1 purified MaxPab rabbit polyclonal antibody (D01P)

ESM1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011082-D01P
ESM1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ESM1 protein.
Información adicional
Size 100 ug
Gene Name ESM1
Gene Alias endocan
Gene Description endothelial cell-specific molecule 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ESM1 (NP_008967.1, 1 a.a. ~ 184 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11082

Enviar un mensaje


ESM1 purified MaxPab rabbit polyclonal antibody (D01P)

ESM1 purified MaxPab rabbit polyclonal antibody (D01P)