ESM1 polyclonal antibody (A01)
  • ESM1 polyclonal antibody (A01)

ESM1 polyclonal antibody (A01)

Ref: AB-H00011082-A01
ESM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ESM1.
Información adicional
Size 50 uL
Gene Name ESM1
Gene Alias endocan
Gene Description endothelial cell-specific molecule 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ESM1 (NP_008967, 85 a.a. ~ 184 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11082

Enviar un mensaje


ESM1 polyclonal antibody (A01)

ESM1 polyclonal antibody (A01)