KERA polyclonal antibody (A01)
  • KERA polyclonal antibody (A01)

KERA polyclonal antibody (A01)

Ref: AB-H00011081-A01
KERA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KERA.
Información adicional
Size 50 uL
Gene Name KERA
Gene Alias CNA2|SLRR2B
Gene Description keratocan
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHLHLDHNKIKSVNVSVICPSPSMLPAERDSFSYGPHLRYLRLDGNEIKPPIPMALMTCFRLLQAVI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KERA (NP_008966, 253 a.a. ~ 351 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11081

Enviar un mensaje


KERA polyclonal antibody (A01)

KERA polyclonal antibody (A01)