DNAJB4 purified MaxPab rabbit polyclonal antibody (D01P)
  • DNAJB4 purified MaxPab rabbit polyclonal antibody (D01P)

DNAJB4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011080-D01P
DNAJB4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DNAJB4 protein.
Información adicional
Size 100 ug
Gene Name DNAJB4
Gene Alias DNAJW|DjB4|HLJ1
Gene Description DnaJ (Hsp40) homolog, subfamily B, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DNAJB4 (NP_008965.2, 1 a.a. ~ 337 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11080

Enviar un mensaje


DNAJB4 purified MaxPab rabbit polyclonal antibody (D01P)

DNAJB4 purified MaxPab rabbit polyclonal antibody (D01P)