TOPBP1 polyclonal antibody (A01)
  • TOPBP1 polyclonal antibody (A01)

TOPBP1 polyclonal antibody (A01)

Ref: AB-H00011073-A01
TOPBP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TOPBP1.
Información adicional
Size 50 uL
Gene Name TOPBP1
Gene Alias TOP2BP1
Gene Description topoisomerase (DNA) II binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LLQSGGAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELGTGLSQKRKAPTEKNKIKRPRVH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOPBP1 (NP_008958, 1327 a.a. ~ 1435 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11073

Enviar un mensaje


TOPBP1 polyclonal antibody (A01)

TOPBP1 polyclonal antibody (A01)