DUSP14 monoclonal antibody (M03), clone 4F6
  • DUSP14 monoclonal antibody (M03), clone 4F6

DUSP14 monoclonal antibody (M03), clone 4F6

Ref: AB-H00011072-M03
DUSP14 monoclonal antibody (M03), clone 4F6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DUSP14.
Información adicional
Size 100 ug
Gene Name DUSP14
Gene Alias MKP-L|MKP6
Gene Description dual specificity phosphatase 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP14 (AAH00370, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11072
Clone Number 4F6
Iso type IgG2b Kappa

Enviar un mensaje


DUSP14 monoclonal antibody (M03), clone 4F6

DUSP14 monoclonal antibody (M03), clone 4F6