DUSP14 monoclonal antibody (M02), clone 4B5-E6
  • DUSP14 monoclonal antibody (M02), clone 4B5-E6

DUSP14 monoclonal antibody (M02), clone 4B5-E6

Ref: AB-H00011072-M02
DUSP14 monoclonal antibody (M02), clone 4B5-E6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant DUSP14.
Información adicional
Size 100 ug
Gene Name DUSP14
Gene Alias MKP-L|MKP6
Gene Description dual specificity phosphatase 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP14 (AAH00370, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11072
Clone Number 4B5-E6
Iso type IgG2a kappa

Enviar un mensaje


DUSP14 monoclonal antibody (M02), clone 4B5-E6

DUSP14 monoclonal antibody (M02), clone 4B5-E6