DUSP14 purified MaxPab rabbit polyclonal antibody (D01P)
  • DUSP14 purified MaxPab rabbit polyclonal antibody (D01P)

DUSP14 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011072-D01P
DUSP14 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DUSP14 protein.
Información adicional
Size 100 ug
Gene Name DUSP14
Gene Alias MKP-L|MKP6
Gene Description dual specificity phosphatase 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DUSP14 (NP_008957.1, 1 a.a. ~ 198 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11072

Enviar un mensaje


DUSP14 purified MaxPab rabbit polyclonal antibody (D01P)

DUSP14 purified MaxPab rabbit polyclonal antibody (D01P)