C10orf10 purified MaxPab mouse polyclonal antibody (B01P)
  • C10orf10 purified MaxPab mouse polyclonal antibody (B01P)

C10orf10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011067-B01P
C10orf10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C10orf10 protein.
Información adicional
Size 50 ug
Gene Name C10orf10
Gene Alias DEPP|FIG
Gene Description chromosome 10 open reading frame 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C10orf10 (NP_008952.1, 1 a.a. ~ 212 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11067

Enviar un mensaje


C10orf10 purified MaxPab mouse polyclonal antibody (B01P)

C10orf10 purified MaxPab mouse polyclonal antibody (B01P)